PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015121-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 253aa    MW: 29055.6 Da    PI: 4.7657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015121-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+l d++k++G  +W+  +r  g++R++k+c++rw +yl
    NNU_015121-RA 14 KGAWTPDEDEKLTDYIKKYGHWNWRELPRFAGLKRCGKSCRLRWVNYL 61
                     79******************99************************97 PP

2Myb_DNA-binding49.97.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++ Edel+ ++++ lG++ W++Ia++++ gRt++++k++w++ 
    NNU_015121-RA  67 RGLFSEGEDELIMNLHESLGNK-WAAIAAKLP-GRTDNEVKNHWHTN 111
                      67899*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-22764IPR009057Homeodomain-like
PROSITE profilePS5129415.078961IPR017930Myb domain
SuperFamilySSF466899.17E-3011108IPR009057Homeodomain-like
SMARTSM007171.5E-121363IPR001005SANT/Myb domain
PfamPF002494.9E-141461IPR001005SANT/Myb domain
CDDcd001672.36E-91661No hitNo description
PROSITE profilePS5129425.94462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2465117IPR009057Homeodomain-like
SMARTSM007171.0E-1366114IPR001005SANT/Myb domain
PfamPF002492.5E-1467111IPR001005SANT/Myb domain
CDDcd001675.51E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MVKTGYCEKT GLKKGAWTPD EDEKLTDYIK KYGHWNWREL PRFAGLKRCG KSCRLRWVNY  60
LRPNIRRGLF SEGEDELIMN LHESLGNKWA AIAAKLPGRT DNEVKNHWHT NLKKRLKQMS  120
ENNLHSHEIS ECKAGVNDMK ELEPDAPFSY VPMDEIGSSP SSSQLPSSDS AAVNGTHWFE  180
DDNIALPETC PEAYYNFWTE PFLAGNSYID EIFFETSVES DLVPPLSLLP PVDPLCVLDF  240
YSDDNMDLFN QLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268905.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLB9I6H84e-72B9I6H8_POPTR; Uncharacterized protein
STRINGPOPTR_0013s14560.11e-71(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-56myb domain protein 14